SCOPe 2.08: Domain d5ganf2: 5gan F:43-346

Lineage for d5ganf2 (5gan F:43-346)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.183: Nop domain [89123] (1 superfamily)
   multihelical; array of longer and shorter helices; contains an alpha-hairpin dimerisation subdomain

4. Superfamily a.183.1: Nop domain [89124] (2 families)

5. Family a.183.1.1: Nop domain [89125] (2 proteins)
   putative snoRNA binding domain

6. Protein U4/U6 small nuclear ribonucleoprotein Prp31 [158762] (2 species)
   contains insertion of a small 4-helical bundle at the tip of a long alpha-hairpin arm; this insertion approximately corresponds to the NOSIC (NUC001) domain; Pfam PF08060

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346215] (1 PDB entry)

8. Domain d5ganf2: 5gan F:43-346 [345633]
   Other proteins in same PDB: d5gane_, d5ganf1, d5gang1, d5gang2, d5ganj_
   complexed with gtp
   has additional subdomain(s) that are not in the common domain

Details for d5ganf2

PDB Entry: 5gan, 3.6 Å

PDB Description: the overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom

PDB Compounds: (F:) Pre-mRNA-processing factor 31

SCOPe Domain Sequences for d5ganf2:

Sequence; same for both SEQRES and ATOM records:

>d5ganf2 a.183.1.1 (F:43-346) U4/U6 small nuclear ribonucleoprotein Prp31 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfeilpesielfrtlalispdrlslsetaqilpkivdlkrilqqqeidfikllpffneii
pliksniklmhnflislysrrfpelsslipsplqyskvisilenenysknesdelffhle
nkakltreqilvltmsmktsfknkepldiktrtqileansilenlwklqedigqyiaski
siiapnvcflvgpeiaaqliahaggvlefsripscniasigknkhlshelhtlesgvrqe
gylfasdmiqkfpvsvhkqmlrmlcakvslaarvdagqkngdrntvlahkwkaelskkar
klse

Timeline for d5ganf2:

• d5ganf2 first appeared in SCOPe 2.07