Lineage for d5ganf2 (5gan F:43-346)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341629Fold a.183: Nop domain [89123] (1 superfamily)
    multihelical; array of longer and shorter helices; contains an alpha-hairpin dimerisation subdomain
  4. 2341630Superfamily a.183.1: Nop domain [89124] (2 families) (S)
  5. 2341631Family a.183.1.1: Nop domain [89125] (2 proteins)
    putative snoRNA binding domain
  6. 2341635Protein U4/U6 small nuclear ribonucleoprotein Prp31 [158762] (2 species)
    contains insertion of a small 4-helical bundle at the tip of a long alpha-hairpin arm; this insertion approximately corresponds to the NOSIC (NUC001) domain; Pfam PF08060
  7. 2341636Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346215] (1 PDB entry)
  8. 2341637Domain d5ganf2: 5gan F:43-346 [345633]
    Other proteins in same PDB: d5gane_, d5ganf1, d5gang1, d5gang2, d5ganj_
    complexed with gtp

Details for d5ganf2

PDB Entry: 5gan (more details), 3.6 Å

PDB Description: the overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
PDB Compounds: (F:) Pre-mRNA-processing factor 31

SCOPe Domain Sequences for d5ganf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ganf2 a.183.1.1 (F:43-346) U4/U6 small nuclear ribonucleoprotein Prp31 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfeilpesielfrtlalispdrlslsetaqilpkivdlkrilqqqeidfikllpffneii
pliksniklmhnflislysrrfpelsslipsplqyskvisilenenysknesdelffhle
nkakltreqilvltmsmktsfknkepldiktrtqileansilenlwklqedigqyiaski
siiapnvcflvgpeiaaqliahaggvlefsripscniasigknkhlshelhtlesgvrqe
gylfasdmiqkfpvsvhkqmlrmlcakvslaarvdagqkngdrntvlahkwkaelskkar
klse

SCOPe Domain Coordinates for d5ganf2:

Click to download the PDB-style file with coordinates for d5ganf2.
(The format of our PDB-style files is described here.)

Timeline for d5ganf2:

  • d5ganf2 is new in SCOPe 2.07-stable