| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.183: Nop domain [89123] (1 superfamily) multihelical; array of longer and shorter helices; contains an alpha-hairpin dimerisation subdomain |
Superfamily a.183.1: Nop domain [89124] (2 families) ![]() |
| Family a.183.1.1: Nop domain [89125] (2 proteins) putative snoRNA binding domain |
| Protein U4/U6 small nuclear ribonucleoprotein Prp31 [158762] (2 species) contains insertion of a small 4-helical bundle at the tip of a long alpha-hairpin arm; this insertion approximately corresponds to the NOSIC (NUC001) domain; Pfam PF08060 |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346215] (1 PDB entry) |
| Domain d5ganf2: 5gan F:43-346 [345633] Other proteins in same PDB: d5gane_, d5ganf1, d5gang1, d5gang2, d5ganj_ complexed with gtp has additional subdomain(s) that are not in the common domain |
PDB Entry: 5gan (more details), 3.6 Å
SCOPe Domain Sequences for d5ganf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ganf2 a.183.1.1 (F:43-346) U4/U6 small nuclear ribonucleoprotein Prp31 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfeilpesielfrtlalispdrlslsetaqilpkivdlkrilqqqeidfikllpffneii
pliksniklmhnflislysrrfpelsslipsplqyskvisilenenysknesdelffhle
nkakltreqilvltmsmktsfknkepldiktrtqileansilenlwklqedigqyiaski
siiapnvcflvgpeiaaqliahaggvlefsripscniasigknkhlshelhtlesgvrqe
gylfasdmiqkfpvsvhkqmlrmlcakvslaarvdagqkngdrntvlahkwkaelskkar
klse
Timeline for d5ganf2:
View in 3DDomains from other chains: (mouse over for more information) d5gane_, d5gang1, d5gang2, d5ganj_ |