Lineage for d4kngp_ (4kng P:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030968Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 3030969Family g.3.9.1: Growth factor receptor domain [57185] (11 proteins)
    Pfam PF00757; Pfam PF14843; Pfam PF15913
    heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures
  6. 3031029Protein automated matches [190609] (1 species)
    not a true protein
  7. 3031030Species Human (Homo sapiens) [TaxId:9606] [187631] (7 PDB entries)
  8. 3031037Domain d4kngp_: 4kng P: [345324]
    automated match to d4cdke_
    complexed with nag, ni

Details for d4kngp_

PDB Entry: 4kng (more details), 2.5 Å

PDB Description: crystal structure of human lgr5-rspo1-rnf43
PDB Compounds: (P:) r-spondin-1

SCOPe Domain Sequences for d4kngp_:

Sequence, based on SEQRES records: (download)

>d4kngp_ g.3.9.1 (P:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmnkcikcki
ehceacfshnfctkckeglylhkgrcypacpegssaangtmec

Sequence, based on observed residues (ATOM records): (download)

>d4kngp_ g.3.9.1 (P:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmnkcikcki
ehceacfshnfctkckeglylhkgrcypacpegc

SCOPe Domain Coordinates for d4kngp_:

Click to download the PDB-style file with coordinates for d4kngp_.
(The format of our PDB-style files is described here.)

Timeline for d4kngp_: