Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) |
Family g.3.9.1: Growth factor receptor domain [57185] (11 proteins) Pfam PF00757; Pfam PF14843; Pfam PF15913 heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures |
Protein Stem cell growth factor R-spondin-1 (Rspo1) Furin (Fu1Fu2) domain [310761] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [311016] (2 PDB entries) |
Domain d4cdke_: 4cdk E: [307107] automated match to d4bspa_ |
PDB Entry: 4cdk (more details), 2.8 Å
SCOPe Domain Sequences for d4cdke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cdke_ g.3.9.1 (E:) Stem cell growth factor R-spondin-1 (Rspo1) Furin (Fu1Fu2) domain {Human (Homo sapiens) [TaxId: 9606]} gsqacakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmnkci kckiehceacfshnfctkckeglylhkgrcypacpegssaangtmecssp
Timeline for d4cdke_: