SCOPe 2.07: Domain d4kngp_: 4kng P:

Lineage for d4kngp_ (4kng P:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (2 families)

5. Family g.3.9.1: Growth factor receptor domain [57185] (10 proteins)
   Pfam PF00757; Pfam PF14843; Pfam PF15913

6. Protein automated matches [190609] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187631] (7 PDB entries)

8. Domain d4kngp_: 4kng P: [345324]
   automated match to d4cdke_
   complexed with nag, ni

Details for d4kngp_

PDB Entry: 4kng, 2.5 Å

PDB Description: crystal structure of human lgr5-rspo1-rnf43

PDB Compounds: (P:) r-spondin-1

SCOPe Domain Sequences for d4kngp_:

Sequence, based on SEQRES records:

>d4kngp_ g.3.9.1 (P:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmnkcikcki
ehceacfshnfctkckeglylhkgrcypacpegssaangtmec

Sequence, based on observed residues (ATOM records):

>d4kngp_ g.3.9.1 (P:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmnkcikcki
ehceacfshnfctkckeglylhkgrcypacpegc

Timeline for d4kngp_:

• d4kngp_ is new in SCOPe 2.07-stable
  
• d4kngp_ appears in the current release, SCOPe 2.08