PDB entry 4kng

View 4kng on RCSB PDB site
Description: Crystal structure of human LGR5-RSPO1-RNF43
Class: Signaling Protein, Membrane Protein
Keywords: Leucine-rich repeat, cysteine-rich domain, furin-repeat, protease-associated domain, ligand recognition, protein-protein interaction, N-linked glycosylation, Membrane protein, Signaling Protein
Deposited on 2013-05-09, released 2013-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.234
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucine-rich repeat-containing g-protein coupled receptor 5
    Species: Homo sapiens [TaxId:9606]
    Gene: LGR5, GPR49, GPR67
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75473 (2-End)
      • expression tag (0-1)
  • Chain 'B':
    Compound: leucine-rich repeat-containing g-protein coupled receptor 5
    Species: Homo sapiens [TaxId:9606]
    Gene: LGR5, GPR49, GPR67
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75473 (2-End)
      • expression tag (0-1)
  • Chain 'E':
    Compound: E3 ubiquitin-protein ligase RNF43
    Species: Homo sapiens [TaxId:9606]
    Gene: RNF43
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: E3 ubiquitin-protein ligase RNF43
    Species: Homo sapiens [TaxId:9606]
    Gene: RNF43
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: r-spondin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: RSPO1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kngm_
  • Chain 'P':
    Compound: r-spondin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: RSPO1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kngp_
  • Heterogens: NI, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download) 
    >4kngM (M:)
gpegsqacakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmn
kcikckiehceacfshnfctkckeglylhkgrcypacpegssaangtmecssaaa

    Sequence, based on observed residues (ATOM records): (download) 
    >4kngM (M:)
cakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmnkcikcki
ehceacfshnfctkckeglylhkgrcypacpegtmecs

  • Chain 'P':
    Sequence, based on SEQRES records: (download) 
    >4kngP (P:)
gpegsqacakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmn
kcikckiehceacfshnfctkckeglylhkgrcypacpegssaangtmecssaaa

    Sequence, based on observed residues (ATOM records): (download) 
    >4kngP (P:)
cakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmnkcikcki
ehceacfshnfctkckeglylhkgrcypacpegc