Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) |
Family g.3.9.1: Growth factor receptor domain [57185] (11 proteins) Pfam PF00757; Pfam PF14843; Pfam PF15913 heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures |
Protein automated matches [190609] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187631] (7 PDB entries) |
Domain d4kngm_: 4kng M: [345323] automated match to d4cdke_ complexed with nag, ni |
PDB Entry: 4kng (more details), 2.5 Å
SCOPe Domain Sequences for d4kngm_:
Sequence, based on SEQRES records: (download)
>d4kngm_ g.3.9.1 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]} cakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmnkcikcki ehceacfshnfctkckeglylhkgrcypacpegssaangtmecs
>d4kngm_ g.3.9.1 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]} cakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmnkcikcki ehceacfshnfctkckeglylhkgrcypacpegtmecs
Timeline for d4kngm_: