| Class b: All beta proteins [48724] (178 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
| Protein Small nuclear ribonucleoprotein F, Smf [82087] (2 species) 3jb9 chains I and n are F subunits from fission yeast; not included because sids are not case sensitive |
| Species Saccharomyces cerevisiae S288c [TaxId:559292] [346236] (1 PDB entry) |
| Domain d3jcmw_: 3jcm W: [344847] Other proteins in same PDB: d3jcmj_, d3jcmo_, d3jcmp_, d3jcmq_, d3jcmr_, d3jcms_, d3jcmt_, d3jcmu_, d3jcmv_, d3jcmx_, d3jcmy_ complexed with gtp, m7m |
PDB Entry: 3jcm (more details), 3.8 Å
SCOPe Domain Sequences for d3jcmw_:
Sequence, based on SEQRES records: (download)
>d3jcmw_ b.38.1.1 (W:) Small nuclear ribonucleoprotein F, Smf {Saccharomyces cerevisiae S288c [TaxId: 559292]}
qpvnpkpflkglvnhrvgvklkfnsteyrgtlvstdnyfnlqlneaeefvagvshgtlge
ifircnnvlyire
>d3jcmw_ b.38.1.1 (W:) Small nuclear ribonucleoprotein F, Smf {Saccharomyces cerevisiae S288c [TaxId: 559292]}
qpvnpkpflkglvnhrvgvklkteyrgtlvstdnyfnlqlneaeefvagvshgtlgeifi
rcnnvlyire
Timeline for d3jcmw_: