Lineage for d3jcmw_ (3jcm W:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2396392Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2396688Protein Small nuclear ribonucleoprotein F, Smf [82087] (2 species)
    3jb9 chains I and n are F subunits from fission yeast; not included because sids are not case sensitive
  7. 2396711Species Saccharomyces cerevisiae S288c [TaxId:559292] [346236] (1 PDB entry)
  8. 2396712Domain d3jcmw_: 3jcm W: [344847]
    Other proteins in same PDB: d3jcmj_, d3jcmo_, d3jcmp_, d3jcmq_, d3jcmr_, d3jcms_, d3jcmt_, d3jcmu_, d3jcmv_, d3jcmx_, d3jcmy_
    complexed with gtp, m7m

Details for d3jcmw_

PDB Entry: 3jcm (more details), 3.8 Å

PDB Description: cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
PDB Compounds: (W:) Small nuclear ribonucleoprotein F

SCOPe Domain Sequences for d3jcmw_:

Sequence, based on SEQRES records: (download)

>d3jcmw_ b.38.1.1 (W:) Small nuclear ribonucleoprotein F, Smf {Saccharomyces cerevisiae S288c [TaxId: 559292]}
qpvnpkpflkglvnhrvgvklkfnsteyrgtlvstdnyfnlqlneaeefvagvshgtlge
ifircnnvlyire

Sequence, based on observed residues (ATOM records): (download)

>d3jcmw_ b.38.1.1 (W:) Small nuclear ribonucleoprotein F, Smf {Saccharomyces cerevisiae S288c [TaxId: 559292]}
qpvnpkpflkglvnhrvgvklkteyrgtlvstdnyfnlqlneaeefvagvshgtlgeifi
rcnnvlyire

SCOPe Domain Coordinates for d3jcmw_:

Click to download the PDB-style file with coordinates for d3jcmw_.
(The format of our PDB-style files is described here.)

Timeline for d3jcmw_: