![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
![]() | Protein Small nuclear ribonucleoprotein E [346048] (1 species) 3jb9 chains H and m are E subunits from fission yeast; not included because sids are not case sensitive |
![]() | Species Saccharomyces cerevisiae S288c [TaxId:559292] [346235] (1 PDB entry) |
![]() | Domain d3jcmv_: 3jcm V: [344846] Other proteins in same PDB: d3jcmj_, d3jcmo_, d3jcmp_, d3jcmq_, d3jcmr_, d3jcms_, d3jcmt_, d3jcmu_, d3jcmw_, d3jcmx_, d3jcmz_ complexed with gtp, m7m |
PDB Entry: 3jcm (more details), 3.8 Å
SCOPe Domain Sequences for d3jcmv_:
Sequence, based on SEQRES records: (download)
>d3jcmv_ b.38.1.1 (V:) Small nuclear ribonucleoprotein E {Saccharomyces cerevisiae S288c [TaxId: 559292]} mvppincifnflqqqtpvtiwlfeqigirikgkivgfdefmnvvideaveipvnsadgke dvekgtplgkillkgdnitlitsa
>d3jcmv_ b.38.1.1 (V:) Small nuclear ribonucleoprotein E {Saccharomyces cerevisiae S288c [TaxId: 559292]} mvppincifnflqqqtpvtiwlfeqigirikgkivgfdefmnvvideaveikedvekkil lkgdnitlitsa
Timeline for d3jcmv_: