![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
![]() | Protein D2 core SNRNP protein [50186] (3 species) 3jb9 chains G and l are D2 subunits from fission yeast; not included because sids are not case sensitive |
![]() | Species Saccharomyces cerevisiae S288c [TaxId:559292] [346232] (1 PDB entry) |
![]() | Domain d3jcmq_: 3jcm Q: [344841] Other proteins in same PDB: d3jcmj_, d3jcmo_, d3jcmp_, d3jcmr_, d3jcms_, d3jcmt_, d3jcmv_, d3jcmw_, d3jcmx_, d3jcmy_, d3jcmz_ complexed with gtp, m7m |
PDB Entry: 3jcm (more details), 3.8 Å
SCOPe Domain Sequences for d3jcmq_:
Sequence, based on SEQRES records: (download)
>d3jcmq_ b.38.1.1 (Q:) D2 core SNRNP protein {Saccharomyces cerevisiae S288c [TaxId: 559292]} eleefefkhgpmslindamvtrtpviislrnnhkiiarvkafdrhcnmvlenvkelwtek kgknvinrerfisklflrgdsvivvlktpv
>d3jcmq_ b.38.1.1 (Q:) D2 core SNRNP protein {Saccharomyces cerevisiae S288c [TaxId: 559292]} eleefefkhgpmslindamvtrtpviislrnnhkiiarvkafdrhcnmvlenvkelwtek kknvinrerfisklflrgdsvivvlktpv
Timeline for d3jcmq_: