Class b: All beta proteins [48724] (178 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
Protein D3 core SNRNP protein [50188] (3 species) |
Species Saccharomyces cerevisiae S288c [TaxId:559292] [346233] (1 PDB entry) |
Domain d3jcmr_: 3jcm R: [344842] Other proteins in same PDB: d3jcmo_, d3jcmp_, d3jcmq_, d3jcms_, d3jcmt_, d3jcmu_, d3jcmv_, d3jcmw_, d3jcmx_, d3jcmy_, d3jcmz_ complexed with gtp, m7m |
PDB Entry: 3jcm (more details), 3.8 Å
SCOPe Domain Sequences for d3jcmr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jcmr_ b.38.1.1 (R:) D3 core SNRNP protein {Saccharomyces cerevisiae S288c [TaxId: 559292]} gipvkllneaqghivslelttgatyrgklvesedsmnvqlrdviatepqgavthmdqifv rgsqikfivvpdllknapl
Timeline for d3jcmr_: