![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
![]() | Protein B core SNRNP protein [50190] (2 species) 3jb9 chains b and E are B subunits from fission yeast; not included because sids are not case sensitive |
![]() | Species Saccharomyces cerevisiae S288c [TaxId:559292] [346229] (1 PDB entry) |
![]() | Domain d3jcmo_: 3jcm O: [344839] Other proteins in same PDB: d3jcmj_, d3jcmp_, d3jcmq_, d3jcmr_, d3jcmt_, d3jcmu_, d3jcmv_, d3jcmw_, d3jcmx_, d3jcmy_, d3jcmz_ complexed with gtp, m7m |
PDB Entry: 3jcm (more details), 3.8 Å
SCOPe Domain Sequences for d3jcmo_:
Sequence, based on SEQRES records: (download)
>d3jcmo_ b.38.1.1 (O:) B core SNRNP protein {Saccharomyces cerevisiae S288c [TaxId: 559292]} hssrlanlidyklrvltqdgrvyigqlmafdkhmnlvlnecieervpktqldklrprkds kdgttlnikvekrvlgltilrgeqilstvvedkpll
>d3jcmo_ b.38.1.1 (O:) B core SNRNP protein {Saccharomyces cerevisiae S288c [TaxId: 559292]} hssrlanlidyklrvltqdgrvyigqlmafdkhmnlvlnecieervvekrvlgltilrge qilstvvedkpll
Timeline for d3jcmo_: