SCOPe 2.08: Domain d3jcmx_: 3jcm X:

Lineage for d3jcmx_ (3jcm X:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
   forms homo and heteroheptameric ring structures
   Pfam PF01423

6. Protein Small nuclear ribonucleoprotein G [346049] (2 species)

7. Species Saccharomyces cerevisiae S288c [TaxId:559292] [346237] (1 PDB entry)
   3jcm chain a is also G subunit; not included because sids are not case sensitive

8. Domain d3jcmx_: 3jcm X: [344848]
   Other proteins in same PDB: d3jcmj_, d3jcmo_, d3jcmp_, d3jcmq_, d3jcmr_, d3jcms_, d3jcmt_, d3jcmu_, d3jcmv_, d3jcmw_, d3jcmy_, d3jcmz_
   complexed with gtp, m7m

Details for d3jcmx_

PDB Entry: 3jcm, 3.8 Å

PDB Description: cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp

PDB Compounds: (X:) Small nuclear ribonucleoprotein G

SCOPe Domain Sequences for d3jcmx_:

Sequence, based on SEQRES records:

>d3jcmx_ b.38.1.1 (X:) Small nuclear ribonucleoprotein G {Saccharomyces cerevisiae S288c [TaxId: 559292]}
mvstpelkkymdkkillningsrkvagilrgydiflnvvlddameingedpannhqlglq
tvirgnsiislealda

Sequence, based on observed residues (ATOM records):

>d3jcmx_ b.38.1.1 (X:) Small nuclear ribonucleoprotein G {Saccharomyces cerevisiae S288c [TaxId: 559292]}
mvstpelkkymdkkillningsrkvagilrgydiflnvvlddameinannhqlgtvirgn
siislealda

Timeline for d3jcmx_:

• d3jcmx_ first appeared in SCOPe 2.07