Lineage for d3jcmj_ (3jcm J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2786772Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2787019Protein D3 core SNRNP protein [50188] (3 species)
  7. 2787027Species Saccharomyces cerevisiae S288c [TaxId:559292] [346233] (1 PDB entry)
  8. 2787028Domain d3jcmj_: 3jcm J: [344838]
    Other proteins in same PDB: d3jcmo_, d3jcmp_, d3jcmq_, d3jcms_, d3jcmt_, d3jcmu_, d3jcmv_, d3jcmw_, d3jcmx_, d3jcmy_, d3jcmz_
    complexed with gtp, m7m

Details for d3jcmj_

PDB Entry: 3jcm (more details), 3.8 Å

PDB Description: cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
PDB Compounds: (J:) Small nuclear ribonucleoprotein Sm D3

SCOPe Domain Sequences for d3jcmj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jcmj_ b.38.1.1 (J:) D3 core SNRNP protein {Saccharomyces cerevisiae S288c [TaxId: 559292]}
gipvkllneaqghivslelttgatyrgklvesedsmnvqlrdviatepqgavthmdqifv
rgsqikfivvpdllknapl

SCOPe Domain Coordinates for d3jcmj_:

Click to download the PDB-style file with coordinates for d3jcmj_.
(The format of our PDB-style files is described here.)

Timeline for d3jcmj_: