Lineage for d1bt4a_ (1bt4 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.67: PLP-dependent transferases [53382] (1 superfamily) Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) 
Family c.67.1.4: omega-Amino acid:pyruvate aminotransferase-like [53417] (11 proteins) 
Protein Phosphoserine aminotransferase, PSAT [53426] (2 species) 
Species Bacillus circulans, subsp. alkalophilus [TaxId:1397] [53427] (1 PDB entry) 
Domain d1bt4a_: 1bt4 A: [34468]
Details for d1bt4a_
PDB Entry: 1bt4 (more details), 2.3 Å
PDB Description: phosphoserine aminotransferase from bacillus circulans subsp. alkalophilus
SCOP Domain Sequences for d1bt4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bt4a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus}
seraynfnagpaalplevleraqaefvdyqhtgmsimemshrgavyeavhneaqarllal
lgnptgykvlfiqggastqfamipmnflkegqtanyvmtgswaskalkeakligdthvaa
sseasnymtlpklqeiqlqdnaaylhltsnetiegaqfkafpdtgsvpligdmssdilsr
pfdlnqfglvyagaqknlgpsgvtvvivredlvaespkhlptmlrydtyvknnslyntpp
sfgiymvnevlkwieergglegvqqanrkkasliydaidqsggfyrgcvdvdsrsdmnit
frlaseelekefvkaseqegfvglkghrsvgglrasiynavpyescealvqfmehfkrsr
g
SCOP Domain Coordinates for d1bt4a_:
Click to download the PDB-style file with coordinates for d1bt4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bt4a_:
- d1bt4a_ appears in SCOP 1.57
- d1bt4a_ appears in the current release, SCOPe 2.08, called d1bt4a1
View in 3D