Lineage for d1bt4a1 (1bt4 A:4-362)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896214Protein Phosphoserine aminotransferase, PSAT [53426] (3 species)
  7. 2896240Species Bacillus circulans, subsp. alkalophilus [TaxId:1397] [53427] (3 PDB entries)
    Uniprot Q59196
  8. 2896244Domain d1bt4a1: 1bt4 A:4-362 [34468]
    Other proteins in same PDB: d1bt4a2
    complexed with plp

Details for d1bt4a1

PDB Entry: 1bt4 (more details), 2.3 Å

PDB Description: phosphoserine aminotransferase from bacillus circulans subsp. alkalophilus
PDB Compounds: (A:) phosphoserine aminotransferase

SCOPe Domain Sequences for d1bt4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bt4a1 c.67.1.4 (A:4-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]}
raynfnagpaalplevleraqaefvdyqhtgmsimemshrgavyeavhneaqarllallg
nptgykvlfiqggastqfamipmnflkegqtanyvmtgswaskalkeakligdthvaass
easnymtlpklqeiqlqdnaaylhltsnetiegaqfkafpdtgsvpligdmssdilsrpf
dlnqfglvyagaqknlgpsgvtvvivredlvaespkhlptmlrydtyvknnslyntppsf
giymvnevlkwieergglegvqqanrkkasliydaidqsggfyrgcvdvdsrsdmnitfr
laseelekefvkaseqegfvglkghrsvgglrasiynavpyescealvqfmehfkrsrg

SCOPe Domain Coordinates for d1bt4a1:

Click to download the PDB-style file with coordinates for d1bt4a1.
(The format of our PDB-style files is described here.)

Timeline for d1bt4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bt4a2