PDB entry 1bt4

View 1bt4 on RCSB PDB site
Description: phosphoserine aminotransferase from bacillus circulans subsp. alkalophilus
Deposited on 1998-09-02, released 1998-09-09
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.184
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bt4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bt4A (A:)
    seraynfnagpaalplevleraqaefvdyqhtgmsimemshrgavyeavhneaqarllal
    lgnptgykvlfiqggastqfamipmnflkegqtanyvmtgswaskalkeakligdthvaa
    sseasnymtlpklqeiqlqdnaaylhltsnetiegaqfkafpdtgsvpligdmssdilsr
    pfdlnqfglvyagaqknlgpsgvtvvivredlvaespkhlptmlrydtyvknnslyntpp
    sfgiymvnevlkwieergglegvqqanrkkasliydaidqsggfyrgcvdvdsrsdmnit
    frlaseelekefvkaseqegfvglkghrsvgglrasiynavpyescealvqfmehfkrsr
    g