SCOPe 2.08: Domain d5nj0a1: 5nj0 A:23-94

Lineage for d5nj0a1 (5nj0 A:23-94)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Ethr repressor [109651] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109652] (34 PDB entries)
   Uniprot P96222 22-215

8. Domain d5nj0a1: 5nj0 A:23-94 [341627]
   Other proteins in same PDB: d5nj0a2
   automated match to d1t56a1
   protein/DNA complex; complexed with 8yw, so4

Details for d5nj0a1

PDB Entry: 5nj0, 2.1 Å

PDB Description: ethr complex

PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5nj0a1:

Sequence; same for both SEQRES and ATOM records:

>d5nj0a1 a.4.1.9 (A:23-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
ddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvnq
admalqtlaenp

Timeline for d5nj0a1:

• d5nj0a1 first appeared in SCOPe 2.06
  
• d5nj0a1 appears in SCOPe 2.07