Lineage for d5nj0a2 (5nj0 A:95-215)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334734Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2334735Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2334736Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2334743Protein Ethr repressor [109978] (2 species)
  7. 2334744Species Mycobacterium tuberculosis [TaxId:1773] [109979] (45 PDB entries)
    Uniprot P96222 22-215
  8. 2334785Domain d5nj0a2: 5nj0 A:95-215 [341628]
    Other proteins in same PDB: d5nj0a1
    automated match to d1t56a2
    protein/DNA complex; complexed with 8yw, so4

Details for d5nj0a2

PDB Entry: 5nj0 (more details), 2.1 Å

PDB Description: ethr complex
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5nj0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nj0a2 a.121.1.1 (A:95-215) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
n

SCOPe Domain Coordinates for d5nj0a2:

Click to download the PDB-style file with coordinates for d5nj0a2.
(The format of our PDB-style files is described here.)

Timeline for d5nj0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5nj0a1