Lineage for d5ocna_ (5ocn A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694784Species Human (Homo sapiens) [TaxId:9606] [186924] (29 PDB entries)
  8. 2694828Domain d5ocna_: 5ocn A: [337237]
    automated match to d2d2wa_
    complexed with k

Details for d5ocna_

PDB Entry: 5ocn (more details), 2.7 Å

PDB Description: crystal structure of the forkhead domain of human foxn1
PDB Compounds: (A:) Forkhead box protein N1

SCOPe Domain Sequences for d5ocna_:

Sequence, based on SEQRES records: (download)

>d5ocna_ a.4.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcf
ekvenksgsssrkgclwalnpakidkmqeelqkwk

Sequence, based on observed residues (ATOM records): (download)

>d5ocna_ a.4.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcf
ekvegclwalnpakidkmqeelqkwk

SCOPe Domain Coordinates for d5ocna_:

Click to download the PDB-style file with coordinates for d5ocna_.
(The format of our PDB-style files is described here.)

Timeline for d5ocna_: