Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186924] (29 PDB entries) |
Domain d5ocna_: 5ocn A: [337237] automated match to d2d2wa_ complexed with k |
PDB Entry: 5ocn (more details), 2.7 Å
SCOPe Domain Sequences for d5ocna_:
Sequence, based on SEQRES records: (download)
>d5ocna_ a.4.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcf ekvenksgsssrkgclwalnpakidkmqeelqkwk
>d5ocna_ a.4.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcf ekvegclwalnpakidkmqeelqkwk
Timeline for d5ocna_: