Lineage for d5ocnc_ (5ocn C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (86 species)
    not a true protein
  7. 2307340Species Human (Homo sapiens) [TaxId:9606] [186924] (20 PDB entries)
  8. 2307368Domain d5ocnc_: 5ocn C: [337227]
    automated match to d2d2wa_
    complexed with k

Details for d5ocnc_

PDB Entry: 5ocn (more details), 2.7 Å

PDB Description: crystal structure of the forkhead domain of human foxn1
PDB Compounds: (C:) Forkhead box protein N1

SCOPe Domain Sequences for d5ocnc_:

Sequence, based on SEQRES records: (download)

>d5ocnc_ a.4.5.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
piysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcfek
venksgsssrkgclwalnpakidkmqeelqkwk

Sequence, based on observed residues (ATOM records): (download)

>d5ocnc_ a.4.5.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
piysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcfek
veclwalnpakidkmqeelqkwk

SCOPe Domain Coordinates for d5ocnc_:

Click to download the PDB-style file with coordinates for d5ocnc_.
(The format of our PDB-style files is described here.)

Timeline for d5ocnc_: