Lineage for d1kspa1 (1ksp A:324-518)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) 
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins) Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) 
Species Escherichia coli [TaxId:562] [53120] (14 PDB entries) 
Domain d1kspa1: 1ksp A:324-518 [33687]
Other proteins in same PDB: d1kspa2
Details for d1kspa1
PDB Entry: 1ksp (more details), 2.3 Å
PDB Description: dna polymerase i klenow fragment (e.c.2.7.7.7) mutant/dna complex
SCOP Domain Sequences for d1kspa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kspa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli}
misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk
SCOP Domain Coordinates for d1kspa1:
Click to download the PDB-style file with coordinates for d1kspa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kspa1:
- d1kspa1 appears in SCOP 1.57
- d1kspa1 appears in the current release, SCOPe 2.08
View in 3D
