Lineage for d1kspa1 (1ksp A:324-518)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71788Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 72015Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 72183Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)
  6. 72206Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
  7. 72212Species Escherichia coli [TaxId:562] [53120] (14 PDB entries)
  8. 72219Domain d1kspa1: 1ksp A:324-518 [33687]
    Other proteins in same PDB: d1kspa2

Details for d1kspa1

PDB Entry: 1ksp (more details), 2.3 Å

PDB Description: dna polymerase i klenow fragment (e.c.2.7.7.7) mutant/dna complex

SCOP Domain Sequences for d1kspa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kspa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli}
misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk

SCOP Domain Coordinates for d1kspa1:

Click to download the PDB-style file with coordinates for d1kspa1.
(The format of our PDB-style files is described here.)

Timeline for d1kspa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kspa2