Lineage for d1kspa2 (1ksp A:519-928)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38209Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 38210Superfamily e.8.1: DNA/RNA polymerases [56672] (4 families) (S)
  5. 38211Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 38212Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 38218Species Escherichia coli [TaxId:562] [56675] (14 PDB entries)
  8. 38225Domain d1kspa2: 1ksp A:519-928 [42980]
    Other proteins in same PDB: d1kspa1

Details for d1kspa2

PDB Entry: 1ksp (more details), 2.3 Å

PDB Description: DNA polymerase I Klenow fragment (E.C.2.7.7.7) mutant/DNA complex

SCOP Domain Sequences for d1kspa2:

Sequence, based on SEQRES records: (download)

>d1kspa2 e.8.1.1 (A:519-928) DNA polymerase I (Klenow fragment) {Escherichia coli}
hkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrlaelekkaheiageef
nlsstkqlqtilfekqgikplkktpggapstseevleelaldyplpkvileyrglaklks
tytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrneegrrirqafiaped
yvivsadysqielrimahlsrdkglltafaegkdihrataaevfglpletvtseqrrsak
ainfgliygmsafglarqlniprkeaqkymdlyferypgvleymertraqakeqgyvetl
dgrrlylpdikssngarraaaeraainapmqgtaadiikramiavdawlqaeqprvrmim
qvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgenwdqah

Sequence, based on observed residues (ATOM records): (download)

>d1kspa2 e.8.1.1 (A:519-928) DNA polymerase I (Klenow fragment) {Escherichia coli}
hkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrlaelekkaheiageef
nlsstkqlqtilfekqgikplkktpstseevleelaldyplpkvileyrglaklkstytd
klplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrneegrrirqafiapedyviv
sadysqielrimahlsrdkglltafaegkdihrataaevfglpletvtseqrrsakainf
gliygmsafglarqlniprkeaqkymdlyferypgvleymertraqakeqgyvetldgrr
lylpdikssngarraaaeraainapmqgtaadiikramiavdawlqaeqprvrmimqvhd
elvfevhkddvdavakqihqlmenctrldvpllvevgsgenwdqah

SCOP Domain Coordinates for d1kspa2:

Click to download the PDB-style file with coordinates for d1kspa2.
(The format of our PDB-style files is described here.)

Timeline for d1kspa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kspa1