SCOPe 2.08: Domain d5mioa2: 5mio A:246-437

Lineage for d5mioa2 (5mio A:246-437)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)

8. Domain d5mioa2: 5mio A:246-437 [336825]
   Other proteins in same PDB: d5mioa1, d5miob1
   automated match to d4i50a2
   complexed with anp, gdp, gtp, loc, mg

Details for d5mioa2

PDB Entry: 5mio, 3.19 Å

PDB Description: kif2c-darpin fusion protein bound to tubulin

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5mioa2:

Sequence; same for both SEQRES and ATOM records:

>d5mioa2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

Timeline for d5mioa2:

• d5mioa2 first appeared in SCOPe 2.06
  
• d5mioa2 appears in SCOPe 2.07