Lineage for d5miob2 (5mio B:246-438)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525736Species Sheep (Ovis aries) [TaxId:9940] [226224] (19 PDB entries)
  8. 2525768Domain d5miob2: 5mio B:246-438 [336823]
    Other proteins in same PDB: d5mioa1, d5miob1
    automated match to d3rycd2
    complexed with anp, gdp, gtp, loc, mg

Details for d5miob2

PDB Entry: 5mio (more details), 3.19 Å

PDB Description: kif2c-darpin fusion protein bound to tubulin
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d5miob2:

Sequence, based on SEQRES records: (download)

>d5miob2 d.79.2.1 (B:246-438) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records): (download)

>d5miob2 d.79.2.1 (B:246-438) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltqyraltvpeltqqmfdsknmmaacdprhg
ryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfi
gnstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda

SCOPe Domain Coordinates for d5miob2:

Click to download the PDB-style file with coordinates for d5miob2.
(The format of our PDB-style files is described here.)

Timeline for d5miob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5miob1