SCOPe 2.08: Domain d5miob1: 5mio B:1-245

Lineage for d5miob1 (5mio B:1-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [224884] (15 PDB entries)

8. Domain d5miob1: 5mio B:1-245 [336822]
   Other proteins in same PDB: d5mioa2, d5miob2
   automated match to d4drxb1
   complexed with anp, gdp, gtp, loc, mg

Details for d5miob1

PDB Entry: 5mio, 3.19 Å

PDB Description: kif2c-darpin fusion protein bound to tubulin

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d5miob1:

Sequence; same for both SEQRES and ATOM records:

>d5miob1 c.32.1.1 (B:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d5miob1:

• d5miob1 first appeared in SCOPe 2.06
  
• d5miob1 appears in SCOPe 2.07