Lineage for d5mioa2 (5mio A:246-437)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201405Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2201524Protein automated matches [227071] (5 species)
    not a true protein
  7. 2201530Species Cow (Bos taurus) [TaxId:9913] [226565] (48 PDB entries)
  8. 2201705Domain d5mioa2: 5mio A:246-437 [336825]
    Other proteins in same PDB: d5mioa1, d5miob1
    automated match to d4i50a2
    complexed with anp, gdp, gtp, loc, mg

Details for d5mioa2

PDB Entry: 5mio (more details), 3.19 Å

PDB Description: kif2c-darpin fusion protein bound to tubulin
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5mioa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mioa2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

SCOPe Domain Coordinates for d5mioa2:

Click to download the PDB-style file with coordinates for d5mioa2.
(The format of our PDB-style files is described here.)

Timeline for d5mioa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mioa1