Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.3: YbeA-like [82371] (5 proteins) Pfam PF02590 |
Protein automated matches [195222] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [333863] (2 PDB entries) |
Domain d5twka1: 5twk A:2-155 [333864] Other proteins in same PDB: d5twka2, d5twkb2, d5twkc2, d5twkd2 automated match to d1ns5b_ protein/RNA complex; complexed with sfg |
PDB Entry: 5twk (more details), 2.1 Å
SCOPe Domain Sequences for d5twka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5twka1 c.116.1.3 (A:2-155) automated matches {Escherichia coli [TaxId: 562]} klqlvavgtkmpdwvqtgfteylrrfpkdmpfelieipagkrgknadikrildkegeqml aaagknrivtldipgkpwdtpqlaaelerwkldgrdvslliggpeglspackaaaeqsws lsaltlphplvrvlvaeslyrawsittnhpyhre
Timeline for d5twka1: