Lineage for d1ns5b_ (1ns5 B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.116: alpha/beta knot [75216] (1 superfamily)
core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knotSuperfamily c.116.1: alpha/beta knot [75217] (9 families) 
known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
all known members have dimeric structures
Family c.116.1.3: YbeA-like [82371] (5 proteins)
Pfam PF02590
Protein Hypothetical protein YbeA [82372] (1 species) Species Escherichia coli [TaxId:562] [82373] (1 PDB entry) 
Domain d1ns5b_: 1ns5 B: [80706]
structural genomics; NESG target ER45
Details for d1ns5b_
PDB Entry: 1ns5 (more details), 1.68 Å
PDB Description: x-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45
PDB Compounds: (B:) Hypothetical protein ybeASCOPe Domain Sequences for d1ns5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ns5b_ c.116.1.3 (B:) Hypothetical protein YbeA {Escherichia coli [TaxId: 562]}
mklqlvavgtkmpdwvqtgfteylrrfpkdmpfelieipagkrgknadikrildkegeqm
laaagknrivtldipgkpwdtpqlaaelerwkldgrdvslliggpeglspackaaaeqsw
slsaltlphplvrvlvaeslyrawsittnhpyhre
SCOPe Domain Coordinates for d1ns5b_:
Click to download the PDB-style file with coordinates for d1ns5b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ns5b_:
- d1ns5b_ first appeared in SCOP 1.63
- d1ns5b_ appears in SCOPe 2.07
View in 3D
