SCOPe 2.08: Domain d1ggmb1: 1ggm B:395-505

Lineage for d1ggmb1 (1ggm B:395-505)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein Glycyl-tRNA synthetase (GlyRS), C-terminal domain [52960] (1 species)

7. Species Thermus thermophilus [TaxId:274] [52961] (3 PDB entries)

8. Domain d1ggmb1: 1ggm B:395-505 [33201]
   Other proteins in same PDB: d1ggma2, d1ggmb2
   protein/RNA complex; complexed with gap

Details for d1ggmb1

PDB Entry: 1ggm, 3.4 Å

PDB Description: glycyl-trna synthetase from thermus thermophilus complexed with glycyl-adenylate

PDB Compounds: (B:) Glycine--tRNA ligase

SCOPe Domain Sequences for d1ggmb1:

Sequence; same for both SEQRES and ATOM records:

>d1ggmb1 c.51.1.1 (B:395-505) Glycyl-tRNA synthetase (GlyRS), C-terminal domain {Thermus thermophilus [TaxId: 274]}
qlapikvaviplvknrpeiteyakrlkarllalglgrvlyedtgnigkayrrhdevgtpf
avtvdydtigqskdgttrlkdtvtvrdrdtmeqirlhvdelegflrerlrw

Timeline for d1ggmb1:

• d1ggmb1 first appeared (with stable ids) in SCOP 1.55
  
• d1ggmb1 appears in SCOPe 2.07