Lineage for d1ggmb1 (1ggm B:395-505)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2489767Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2489768Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2489769Protein Glycyl-tRNA synthetase (GlyRS), C-terminal domain [52960] (1 species)
  7. 2489770Species Thermus thermophilus [TaxId:274] [52961] (3 PDB entries)
  8. 2489774Domain d1ggmb1: 1ggm B:395-505 [33201]
    Other proteins in same PDB: d1ggma2, d1ggmb2
    protein/RNA complex; complexed with gap

Details for d1ggmb1

PDB Entry: 1ggm (more details), 3.4 Å

PDB Description: glycyl-trna synthetase from thermus thermophilus complexed with glycyl-adenylate
PDB Compounds: (B:) Glycine--tRNA ligase

SCOPe Domain Sequences for d1ggmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggmb1 c.51.1.1 (B:395-505) Glycyl-tRNA synthetase (GlyRS), C-terminal domain {Thermus thermophilus [TaxId: 274]}
qlapikvaviplvknrpeiteyakrlkarllalglgrvlyedtgnigkayrrhdevgtpf
avtvdydtigqskdgttrlkdtvtvrdrdtmeqirlhvdelegflrerlrw

SCOPe Domain Coordinates for d1ggmb1:

Click to download the PDB-style file with coordinates for d1ggmb1.
(The format of our PDB-style files is described here.)

Timeline for d1ggmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ggmb2