Lineage for d1ggmb1 (1ggm B:395-505)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24691Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
  4. 24692Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 24693Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (3 proteins)
  6. 24694Protein Glycyl-tRNA synthetase (GlyRS), C-terminal domain [52960] (1 species)
  7. 24695Species Thermus thermophilus [TaxId:274] [52961] (3 PDB entries)
  8. 24701Domain d1ggmb1: 1ggm B:395-505 [33201]
    Other proteins in same PDB: d1ggma2, d1ggmb2

Details for d1ggmb1

PDB Entry: 1ggm (more details), 3.4 Å

PDB Description: glycyl-trna synthetase from thermus thermophilus complexed with glycyl-adenylate

SCOP Domain Sequences for d1ggmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggmb1 c.51.1.1 (B:395-505) Glycyl-tRNA synthetase (GlyRS), C-terminal domain {Thermus thermophilus}
qlapikvaviplvknrpeiteyakrlkarllalglgrvlyedtgnigkayrrhdevgtpf
avtvdydtigqskdgttrlkdtvtvrdrdtmeqirlhvdelegflrerlrw

SCOP Domain Coordinates for d1ggmb1:

Click to download the PDB-style file with coordinates for d1ggmb1.
(The format of our PDB-style files is described here.)

Timeline for d1ggmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ggmb2