Lineage for d1ggma2 (1ggm A:1-394)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2967618Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2967677Protein Glycyl-tRNA synthetase (GlyRS) [55692] (1 species)
  7. 2967678Species Thermus thermophilus [TaxId:274] [55693] (3 PDB entries)
  8. 2967681Domain d1ggma2: 1ggm A:1-394 [40749]
    Other proteins in same PDB: d1ggma1, d1ggmb1
    protein/RNA complex; complexed with gap
    has additional insertions and/or extensions that are not grouped together

Details for d1ggma2

PDB Entry: 1ggm (more details), 3.4 Å

PDB Description: glycyl-trna synthetase from thermus thermophilus complexed with glycyl-adenylate
PDB Compounds: (A:) Glycine--tRNA ligase

SCOPe Domain Sequences for d1ggma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggma2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]}
aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
egldasvlthrlvlhysgheatfadpmvdnakarywtppryfnmmfqdlrgprggrglla
ylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmeieyf
vrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfphgsl
elegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviepsag
vdrgvlallaeaftreelpngeerivlklkp

SCOPe Domain Coordinates for d1ggma2:

Click to download the PDB-style file with coordinates for d1ggma2.
(The format of our PDB-style files is described here.)

Timeline for d1ggma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ggma1