Lineage for d1pklc3 (1pkl C:358-498)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24606Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
  4. 24607Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family) (S)
  5. 24608Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 24609Protein Pyruvate kinase, C-terminal domain [52937] (5 species)
  7. 24630Species Leishmania mexicana [TaxId:5665] [52940] (1 PDB entry)
  8. 24633Domain d1pklc3: 1pkl C:358-498 [33136]
    Other proteins in same PDB: d1pkla1, d1pkla2, d1pklb1, d1pklb2, d1pklc1, d1pklc2, d1pkld1, d1pkld2, d1pkle1, d1pkle2, d1pklf1, d1pklf2, d1pklg1, d1pklg2, d1pklh1, d1pklh2

Details for d1pklc3

PDB Entry: 1pkl (more details), 2.35 Å

PDB Description: the structure of leishmania pyruvate kinase

SCOP Domain Sequences for d1pklc3:

Sequence, based on SEQRES records: (download)

>d1pklc3 c.49.1.1 (C:358-498) Pyruvate kinase, C-terminal domain {Leishmania mexicana}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycv
vihadhkvkgyanqtrillve

Sequence, based on observed residues (ATOM records): (download)

>d1pklc3 c.49.1.1 (C:358-498) Pyruvate kinase, C-terminal domain {Leishmania mexicana}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycv
vihadanqtrillve

SCOP Domain Coordinates for d1pklc3:

Click to download the PDB-style file with coordinates for d1pklc3.
(The format of our PDB-style files is described here.)

Timeline for d1pklc3: