PDB entry 1pkl

View 1pkl on RCSB PDB site
Description: the structure of leishmania pyruvate kinase
Deposited on 1998-09-15, released 1998-09-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.209
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pklA (A:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pklA (A:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    aanqtrillve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pklB (B:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pklB (B:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvia
    nqtrillve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pklC (C:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pklC (C:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adanqtrillve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pklD (D:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pklD (D:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adhanqtrillve
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1pklE (E:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pklE (E:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adhanqtrillve
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pklF (F:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pklF (F:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    aanqtrillve
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pklG (G:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adhkvkgyanqtrillve
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1pklH (H:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pklH (H:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adanqtrillve