Lineage for d1pkle1 (1pkl E:88-186)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16389Fold b.58: Pyruvate kinase beta-barrel domain [50799] (1 superfamily)
  4. 16390Superfamily b.58.1: Pyruvate kinase beta-barrel domain [50800] (1 family) (S)
  5. 16391Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
  6. 16392Protein Pyruvate kinase [50802] (5 species)
  7. 16413Species Leishmania mexicana [TaxId:5665] [50805] (1 PDB entry)
  8. 16418Domain d1pkle1: 1pkl E:88-186 [27056]
    Other proteins in same PDB: d1pkla2, d1pkla3, d1pklb2, d1pklb3, d1pklc2, d1pklc3, d1pkld2, d1pkld3, d1pkle2, d1pkle3, d1pklf2, d1pklf3, d1pklg2, d1pklg3, d1pklh2, d1pklh3

Details for d1pkle1

PDB Entry: 1pkl (more details), 2.35 Å

PDB Description: the structure of leishmania pyruvate kinase

SCOP Domain Sequences for d1pkle1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkle1 b.58.1.1 (E:88-186) Pyruvate kinase {Leishmania mexicana}
eirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgnyiyiddgi
lilqvqshedeqtlectvtnshtisdrrgvnlpgcdvdl

SCOP Domain Coordinates for d1pkle1:

Click to download the PDB-style file with coordinates for d1pkle1.
(The format of our PDB-style files is described here.)

Timeline for d1pkle1: