SCOPe 2.08: Domain d5tisk_: 5tis K:

Lineage for d5tisk_ (5tis K:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families)
   automatically mapped to Pfam PF02533

5. Family f.23.36.0: automated matches [327289] (1 protein)
   not a true family

6. Protein automated matches [327290] (1 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [327291] (4 PDB entries)

8. Domain d5tisk_: 5tis K: [327292]
   Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tisj_, d5tisl_, d5tism_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
   automated match to d2axtk1
   complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisk_

PDB Entry: 5tis, 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex

PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d5tisk_:

Sequence; same for both SEQRES and ATOM records:

>d5tisk_ f.23.36.0 (K:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

Timeline for d5tisk_:

• d5tisk_ first appeared in SCOPe 2.06
  
• d5tisk_ appears in SCOPe 2.07