SCOPe 2.08: Domain d5tisa_: 5tis A:

Lineage for d5tisa_ (5tis A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (17 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [260543] (10 PDB entries)

8. Domain d5tisa_: 5tis A: [327728]
   Other proteins in same PDB: d5tisb_, d5tisc_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tisj_, d5tisk_, d5tisl_, d5tism_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
   automated match to d2axta1
   complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisa_

PDB Entry: 5tis, 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex

PDB Compounds: (A:) Photosystem II protein D1 1

SCOPe Domain Sequences for d5tisa_:

Sequence; same for both SEQRES and ATOM records:

>d5tisa_ f.26.1.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
anlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgs
llygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrq
welsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaeh
nilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniva
ahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvidak
gnvintwadiinranlgmevmhernahnfpldla

Timeline for d5tisa_:

• d5tisa_ first appeared in SCOPe 2.06
  
• d5tisa_ appears in SCOPe 2.07