Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) |
Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
Protein automated matches [191000] (6 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [326602] (6 PDB entries) |
Domain d5tise_: 5tis E: [327765] Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tish_, d5tisi_, d5tisj_, d5tisk_, d5tisl_, d5tism_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_ automated match to d2axte1 complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5tis (more details), 2.25 Å
SCOPe Domain Sequences for d5tise_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tise_ f.23.38.1 (E:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} ttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsi plvtdrfeakqqvetfleqlk
Timeline for d5tise_: