Lineage for d5tisj_ (5tis J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026440Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) (S)
    automatically mapped to Pfam PF01788
  5. 3026441Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 3026451Protein automated matches [191002] (3 species)
    not a true protein
  7. 3026452Species Thermosynechococcus elongatus [TaxId:197221] [327287] (3 PDB entries)
  8. 3026453Domain d5tisj_: 5tis J: [327288]
    Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tisk_, d5tisl_, d5tism_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
    automated match to d4ub8j_
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisj_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d5tisj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tisj_ f.23.32.1 (J:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
ggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d5tisj_:

Click to download the PDB-style file with coordinates for d5tisj_.
(The format of our PDB-style files is described here.)

Timeline for d5tisj_: