SCOPe 2.08: Domain d1culc2: 1cul C:39-65,C:202-386

Lineage for d1culc2 (1cul C:39-65,C:202-386)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries)
   Uniprot P04896 39-388

8. Domain d1culc2: 1cul C:39-65,C:202-386 [32087]
   Other proteins in same PDB: d1cula_, d1culb_, d1culc1
   complexed with 103, 3po, cl, fok, gsp, mes, mg
   has additional subdomain(s) that are not in the common domain

Details for d1culc2

PDB Entry: 1cul, 2.4 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2',5'-dideoxy-adenosine 3'-triphosphate and mg

PDB Compounds: (C:) guanine nucleotide-binding protein g(s)

SCOPe Domain Sequences for d1culc2:

Sequence; same for both SEQRES and ATOM records:

>d1culc2 c.37.1.8 (C:39-65,C:202-386) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrm

Timeline for d1culc2:

• d1culc2 first appeared (with stable ids) in SCOP 1.55
  
• d1culc2 appears in SCOPe 2.07