Lineage for d1cula_ (1cul A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species)
  7. Species Dog (Canis familiaris) [TaxId:9615] [55078] (15 PDB entries)
    Uniprot P30803 458-646
  8. Domain d1cula_: 1cul A: [39417]
    Other proteins in same PDB: d1culb_, d1culc1, d1culc2
    complexed with 103, 3po, cl, fok, gsp, mes, mg

Details for d1cula_

PDB Entry: 1cul (more details), 2.4 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2',5'-dideoxy-adenosine 3'-triphosphate and mg
PDB Compounds: (A:) type v adenylyl cyclase

SCOPe Domain Sequences for d1cula_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cula_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]}
mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
hsietflil

SCOPe Domain Coordinates for d1cula_ are not available.

Timeline for d1cula_:

Domains from other chains:
(mouse over for more information)
d1culb_, d1culc1, d1culc2