Lineage for d1culb_ (1cul B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. Protein Adenylyl cyclase IIC1, domain C2a [55079] (1 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [55080] (7 PDB entries)
  8. Domain d1culb_: 1cul B: [39424]
    Other proteins in same PDB: d1cula_, d1culc1, d1culc2
    complexed with 103, 3po, cl, fok, gsp, mes, mg

Details for d1culb_

PDB Entry: 1cul (more details), 2.4 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2',5'-dideoxy-adenosine 3'-triphosphate and mg
PDB Compounds: (B:) type II adenylyl cyclase

SCOPe Domain Sequences for d1culb_:

Sequence, based on SEQRES records: (download)

>d1culb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgveki
ktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklr
vginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytct
crgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records): (download)

>d1culb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgveki
ktigstymaatglsaerqymhigtmvefayalvgkldainkhsfndfklrvginhgpvia
gvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgk
gdlktyfvnt

SCOPe Domain Coordinates for d1culb_ are not available.

Timeline for d1culb_:

Domains from other chains:
(mouse over for more information)
d1cula_, d1culc1, d1culc2