Lineage for d1hurb_ (1hur B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866676Protein ADP-ribosylation factor [52614] (17 species)
  7. 2866686Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (14 PDB entries)
    Uniprot P32889
  8. 2866704Domain d1hurb_: 1hur B: [32053]
    complexed with gdp, mg

Details for d1hurb_

PDB Entry: 1hur (more details), 2 Å

PDB Description: human adp-ribosylation factor 1 complexed with gdp, full length non-myristoylated
PDB Compounds: (B:) human ADP-ribosylation factor 1

SCOPe Domain Sequences for d1hurb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hurb_ c.37.1.8 (B:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
sftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavl
lvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk

SCOPe Domain Coordinates for d1hurb_:

Click to download the PDB-style file with coordinates for d1hurb_.
(The format of our PDB-style files is described here.)

Timeline for d1hurb_: