Lineage for d1hurb_ (1hur B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23122Protein ADP-ribosylation factor [52614] (4 species)
  7. 23123Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (1 PDB entry)
  8. 23125Domain d1hurb_: 1hur B: [32053]

Details for d1hurb_

PDB Entry: 1hur (more details), 2 Å

PDB Description: human adp-ribosylation factor 1 complexed with gdp, full length non-myristoylated
PDB Compounds: (B:)

SCOP Domain Sequences for d1hurb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hurb_ c.37.1.8 (B:) ADP-ribosylation factor {Human (Homo sapiens), ARF1}
gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
sftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavl
lvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk

SCOP Domain Coordinates for d1hurb_:

Click to download the PDB-style file with coordinates for d1hurb_.
(The format of our PDB-style files is described here.)

Timeline for d1hurb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hura_