PDB entry 1hur

View 1hur on RCSB PDB site
Description: human ADP-ribosylation factor 1 complexed with GDP, full length non-myristoylated
Class: protein transport
Keywords: GDP-binding, membrane traffickin, non-myristoylated, protein transport
Deposited on 1995-04-19, released 1995-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human ADP-ribosylation factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HARF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hura_
  • Chain 'B':
    Compound: human ADP-ribosylation factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HARF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hurb_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hurA (A:)
    gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
    sftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavl
    lvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hurB (B:)
    gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
    sftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavl
    lvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk