SCOPe 2.08: Domain d1cxza_: 1cxz A:

Lineage for d1cxza_ (1cxz A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein RhoA [52612] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52613] (39 PDB entries)
   Uniprot P61586 2-181

8. Domain d1cxza_: 1cxz A: [32048]
   Other proteins in same PDB: d1cxzb_
   complexed with gsp, mg

Details for d1cxza_

PDB Entry: 1cxz, 2.2 Å

PDB Description: crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1

PDB Compounds: (A:) protein (his-tagged transforming protein rhoa(0-181))

SCOPe Domain Sequences for d1cxza_:

Sequence; same for both SEQRES and ATOM records:

>d1cxza_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
smaairkklvivgdvacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwd
tagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkk
dlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraal
qa

Timeline for d1cxza_:

• d1cxza_ first appeared (with stable ids) in SCOP 1.55
  
• d1cxza_ appears in SCOPe 2.07