PDB entry 1cxz

View 1cxz on RCSB PDB site
Description: crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1
Class: signaling protein
Keywords: protein-protein complex, antiparallel coiled-coil, signaling protein
Deposited on 1999-08-31, released 1999-10-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (his-tagged transforming protein rhoa(0-181))
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61586 (0-181)
    • engineered mutation (14)
    • insertion; see remark 999 (0)
  Domains in SCOPe 2.08: d1cxza_
• Chain 'B':
  Compound: protein (pkn)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q16512 (0-85)
  Domains in SCOPe 2.08: d1cxzb_
• Heterogens: MG, GSP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cxzA (A:)
  smaairkklvivgdvacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwd
  tagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkk
  dlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraal
  qa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cxzB (B:)
  wslleqlglagadlaapgvqqqlelererlrreirkelklkegaenlrrattdlgrslgp
  velllrgssrrldllhqqlqelhahv