Lineage for d1cxza_ (1cxz A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23308Protein RhoA [52612] (1 species)
  7. 23309Species Human (Homo sapiens) [TaxId:9606] [52613] (6 PDB entries)
  8. 23313Domain d1cxza_: 1cxz A: [32048]
    Other proteins in same PDB: d1cxzb_

Details for d1cxza_

PDB Entry: 1cxz (more details), 2.2 Å

PDB Description: crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1

SCOP Domain Sequences for d1cxza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxza_ c.37.1.8 (A:) RhoA {Human (Homo sapiens)}
smaairkklvivgdvacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwd
tagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkk
dlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraal
qa

SCOP Domain Coordinates for d1cxza_:

Click to download the PDB-style file with coordinates for d1cxza_.
(The format of our PDB-style files is described here.)

Timeline for d1cxza_: