![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.6: HR1 repeat [46585] (1 family) ![]() |
![]() | Family a.2.6.1: HR1 repeat [46586] (2 proteins) protein kinase effector domain this is a repeat family; one repeat unit is 1urf A:122-199 found in domain |
![]() | Protein Protein kinase c-like 1, pkn/prk1 [46587] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46588] (3 PDB entries) |
![]() | Domain d1cxzb_: 1cxz B: [15705] Other proteins in same PDB: d1cxza_ first HR1 domain complexed with RhoA complexed with gsp, mg |
PDB Entry: 1cxz (more details), 2.2 Å
SCOPe Domain Sequences for d1cxzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxzb_ a.2.6.1 (B:) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens) [TaxId: 9606]} wslleqlglagadlaapgvqqqlelererlrreirkelklkegaenlrrattdlgrslgp velllrgssrrldllhqqlqelhahv
Timeline for d1cxzb_: