Lineage for d1cxzb_ (1cxz B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689945Superfamily a.2.6: HR1 repeat [46585] (1 family) (S)
  5. 2689946Family a.2.6.1: HR1 repeat [46586] (2 proteins)
    protein kinase effector domain
    this is a repeat family; one repeat unit is 1urf A:122-199 found in domain
  6. 2689947Protein Protein kinase c-like 1, pkn/prk1 [46587] (1 species)
  7. 2689948Species Human (Homo sapiens) [TaxId:9606] [46588] (3 PDB entries)
  8. 2689949Domain d1cxzb_: 1cxz B: [15705]
    Other proteins in same PDB: d1cxza_
    first HR1 domain complexed with RhoA
    complexed with gsp, mg

Details for d1cxzb_

PDB Entry: 1cxz (more details), 2.2 Å

PDB Description: crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1
PDB Compounds: (B:) protein (pkn)

SCOPe Domain Sequences for d1cxzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxzb_ a.2.6.1 (B:) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens) [TaxId: 9606]}
wslleqlglagadlaapgvqqqlelererlrreirkelklkegaenlrrattdlgrslgp
velllrgssrrldllhqqlqelhahv

SCOPe Domain Coordinates for d1cxzb_:

Click to download the PDB-style file with coordinates for d1cxzb_.
(The format of our PDB-style files is described here.)

Timeline for d1cxzb_: